Basic Information | |
---|---|
Taxon OID | 3300029668 Open in IMG/M |
Scaffold ID | Ga0245235_134843 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36119 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 518 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | United Kingdom: London | |||||||
Coordinates | Lat. (o) | 51.5 | Long. (o) | -0.12 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081354 | Metagenome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0245235_1348433 | F081354 | N/A | VRENQQSSAHNFVKDFSLIFLKFSRRSPLKKGAATENPLEYGKTEVQILFEPLQAAISSMELPKNFENKKLPNPLR |
⦗Top⦘ |