NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0135224_1034540

Scaffold Ga0135224_1034540


Overview

Basic Information
Taxon OID3300029753 Open in IMG/M
Scaffold IDGa0135224_1034540 Open in IMG/M
Source Dataset NameMarine harbor viral communities from the Indian Ocean - SRH3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMichigan State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)552
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location
Location NameIndian Ocean
CoordinatesLat. (o)1.26600833Long. (o)103.8333333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105326Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0135224_10345402F105326AGGAMGQERNLTPTQHWELHQGLWHMLGCDMQLKYKDRTTAIYVDNKAKLKYTYSTKGFIKWFPISKENKI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.