Scaffold Ga0134843_1003814

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134843_1003814

Scaffold Ga0134843_1003814

Overview

Basic Information
Taxon OID	3300029775 Open in IMG/M
Scaffold ID	Ga0134843_1003814 Open in IMG/M
Source Dataset Name	Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-4-1-220-B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chongqing University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7734
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (28.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location Name	China: Luzhou
Coordinates	Lat. (^o)	28.88	Long. (^o)	105.45	Alt. (m)		Depth (m)	.01
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028664	Metagenome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134843_10038141	F028664	AGTAG	MKENSKILIGGQALRNLGSDRYTEDVDFLVNDKSTTDAFINTVGIDYINANGNKFFNEIYNIEKGNIQATPRSLFELKVYAFVQHCQNFNFAKADSCEYDLKFLVRNFNITESKIARKYITNGEYSEIVKIVRSVKF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.