NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243129_1179545

Scaffold Ga0243129_1179545


Overview

Basic Information
Taxon OID3300029797 Open in IMG/M
Scaffold IDGa0243129_1179545 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellow Sea, Weihai, China - HGD.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShandong University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment → Sediment Microbial Communities From Yellow Sea, Weihai, China

Source Dataset Sampling Location
Location NameChina: Weihai
CoordinatesLat. (o)37.31Long. (o)122.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011154Metagenome / Metatranscriptome294Y

Sequences

Protein IDFamilyRBSSequence
Ga0243129_11795451F011154N/ATRSDEKPLRVGLRRPGQFRAWANRSYPEGIRLLLCISTGGRLGRSPEGDRPNERRRKAGQSERPNREGHAASAGPVKTFREVGGVKNDTADLWTKGNLRVKRRDPWHRANAPSKAAADPALSGQDADQKTQTCLDLVRKPVAQPPAQAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.