NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244882_1001435

Scaffold Ga0244882_1001435


Overview

Basic Information
Taxon OID3300029815 Open in IMG/M
Scaffold IDGa0244882_1001435 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Shanghai, China - P010V6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27568
Total Scaffold Genes39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (74.36%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location NameChina: Shanghai
CoordinatesLat. (o)31.2112312Long. (o)121.4647709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082887Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0244882_100143534F082887GGAMEKIKKIAKYTTNVLAIIGALVTGINGVDNITIPYATQIIQIIAVLQGVIGTYLLSNKVINK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.