NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0246092_1006144

Scaffold Ga0246092_1006144


Overview

Basic Information
Taxon OID3300029821 Open in IMG/M
Scaffold IDGa0246092_1006144 Open in IMG/M
Source Dataset NameGroundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig3392
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Berkeley
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5621
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Source Dataset Sampling Location
Location NameJapan: Horonobe URL
CoordinatesLat. (o)45.045278Long. (o)141.859444Alt. (m)Depth (m)215
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081380Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0246092_10061443F081380GAGMNRASEYLNIPDGKRLWLRDFQPHFNSLVLDPIKRFPLQMGDVLIGFVFMSCCIDYLAGFWWGENRGTGMVRQAYTGFINEYFRPRGLYNAKGLYDSLRNGLVHLFTIKDRIYELTFDEPERHLTVSHNGFIILNAGSFRNDLINAANLYFNELKKNPQLLDKAFQRYERDGFVRWID
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.