NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134835_1001038

Scaffold Ga0134835_1001038


Overview

Basic Information
Taxon OID3300029825 Open in IMG/M
Scaffold IDGa0134835_1001038 Open in IMG/M
Source Dataset NameLiquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChongqing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33479
Total Scaffold Genes58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)50 (86.21%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location NameChina: Luzhou
CoordinatesLat. (o)28.88Long. (o)105.45Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004383Metagenome / Metatranscriptome440Y
F010099Metagenome / Metatranscriptome308Y
F033857Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0134835_10010382F010099N/AMTDTKTSFWTPARIGAVIGAVLLVVALAYLVSLPQNKFVHADLLEPTYAADADLGFWMVDKYDQEVDVYHLLVVMEHPNGTFEWLDGDGIWLPRRAVEGTFTVNYPPLKGWACPSISPLLDLRSGVQ
Ga0134835_100103850F004383GGAGGMAGDCDGQSAPDNVLERAFMARLRADEYRAELKALEKEFNDREDVIAIRRKIDRCEHERQTYIEQAKAAGISKIGNYLLKIRTRKTRTVVPKLFFAKHGAEAFVECCTVAIGKAEALLGKSALDDCCEVEVKEIGVSVEYERPEAVE
Ga0134835_10010389F033857AGCAGGMVEIIDLSTLSPKPVIVRIGNGSEIEEIDLTIVPARGTLTLTQATQEHGGFDKIPDGEMVMAIADICHISNPKITYEWLMANLTRPQLAGLTQVVIAQAFRRWGGGDKGDKEGEVKNP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.