Scaffold Ga0134835_1073723

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134835_1073723

Scaffold Ga0134835_1073723

Overview

Basic Information
Taxon OID	3300029825 Open in IMG/M
Scaffold ID	Ga0134835_1073723 Open in IMG/M
Source Dataset Name	Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chongqing University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	799
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location Name	China: Luzhou
Coordinates	Lat. (^o)	28.88	Long. (^o)	105.45	Alt. (m)		Depth (m)	.01
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064748	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134835_10737233	F064748	N/A	IGNVEDVTPCGSMDADCIAAGCKGKVWGQCHFDPLLNLLSSGNEYYTEILTECVIRDTIFRVEKDGLFSSGGLNPLFVKNGKTWMKRGHVKNHFKQQSLYNCETHTPIYLYQEYPGDAEVVCTC

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.