Basic Information | |
---|---|
Taxon OID | 3300029826 Open in IMG/M |
Scaffold ID | Ga0134619_1034565 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Jimmy Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - N0247 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Battelle Memorial Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1132 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Bay Jimmy | |||||||
Coordinates | Lat. (o) | 29.44 | Long. (o) | -89.903 | Alt. (m) | Depth (m) | .02 to .04 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075038 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134619_10345652 | F075038 | GGAG | MSKTWELQKGNILVVEDANTASLVIVVKDLKKKEDKIVALEEIIQKMRND |
⦗Top⦘ |