NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134606_10015684

Scaffold Ga0134606_10015684


Overview

Basic Information
Taxon OID3300029827 Open in IMG/M
Scaffold IDGa0134606_10015684 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBattelle Memorial Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2839
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion

Source Dataset Sampling Location
Location NameUSA: Barataria Bay
CoordinatesLat. (o)29.468Long. (o)-89.882Alt. (m)Depth (m).08 to .12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076930Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0134606_100156843F076930GAGMTEKPITELTRRAHDLGFRQGYEIANRTPIDASISQEEFVNLVLETAQNSLESTVFESISAELESMNAKYPAFDGWTVFAEGVIKGAGENFMDRTGNQE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.