Scaffold Ga0245137_105017

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0245137_105017

Scaffold Ga0245137_105017

Overview

Basic Information
Taxon OID	3300029830 Open in IMG/M
Scaffold ID	Ga0245137_105017 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36034
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5122
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (35.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Source Dataset Sampling Location
Location Name	United Kingdom: London
Coordinates	Lat. (^o)	51.5	Long. (^o)	-0.12	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083451	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0245137_10501712	F083451	N/A	MEEKDVLNLLMSRKDIRKLVEKSNKCYSKMDFVGAMKYRKQIKDVIDHESRIMLTRSESLIELMNGSGDEYKFKMLVWLHSMMCMADVFNGILEDFKDGVRKANGNSKFIKFDNLDRLMTECKKEIDYLMKGTSKSFQISFAVRSDEMREMIENMVGDNIREGYDMFKEEAKMTKETDRSKIEEFNKKLDHDQM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.