NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311327_10264427

Scaffold Ga0311327_10264427


Overview

Basic Information
Taxon OID3300029883 Open in IMG/M
Scaffold IDGa0311327_10264427 Open in IMG/M
Source Dataset NameI_Bog_E2 coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1137
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0477Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002396Metagenome / Metatranscriptome564Y
F099394Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0311327_102644272F002396GAGGMRSLFPSTYDRADVLMSAGCSTFVSAALILVIPRVGIILLEILLGLFFIGCALAARARLRIQARSQVKEGPEGSTNAKAKWFDRYDVLMILTVVAVYSSVSGLLRHAGLSEGTVGILPLILFAAGILLKARAVQFIERRRKDRTAGTHDGRAHVDAGKKQEIARKETVERCR
Ga0311327_102644274F099394N/ADIGFSFLTTSEVVLPLTERQNPRKSGCFQETEVSSI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.