Scaffold Ga0246236_1003237

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0246236_1003237

Scaffold Ga0246236_1003237

Overview

Basic Information
Taxon OID	3300029893 Open in IMG/M
Scaffold ID	Ga0246236_1003237 Open in IMG/M
Source Dataset Name	Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2012_MF
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Princeton University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6178
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid → Fracture Fluid Microbial Communities From Borehole On The 26 Level Of Beatrix Gold Mine, Welkom, South Africa

Source Dataset Sampling Location
Location Name	South Africa: Welkom
Coordinates	Lat. (^o)	-28.232288	Long. (^o)	26.794365	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0246236_100323716	F015419	N/A	MEYKVQITDEAGNVQQYVVSRSSSSEDKSLNDFILEALRISEDKRKLPLKIQCPNGLEVYPKLKMKFKNFGNPLLEDELESLHITW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.