Scaffold Ga0247319_1008997

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247319_1008997

Scaffold Ga0247319_1008997

Overview

Basic Information
Taxon OID	3300029904 Open in IMG/M
Scaffold ID	Ga0247319_1008997 Open in IMG/M
Source Dataset Name	Fecal microbial communities from Lean line chicken in Harbin, China - MGJ1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Inner Mongolia Agricultural University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3739
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Birds → Digestive System → Fecal → Unclassified → Fecal → Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China

Source Dataset Sampling Location
Location Name	China: Harbin
Coordinates	Lat. (^o)	45.73	Long. (^o)	126.73	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047755	Metagenome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247319_10089973	F047755	N/A	MQQEKVKYLIDMINNMDIKDKLRLAICMSQSKWSGLIYNTKDYYERFDSMLKDIDEEYRTTLINFEKYKIVMXXXXMAKLMEMETTEQNKVALYLFNDIK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.