Basic Information | |
---|---|
Taxon OID | 3300029919 Open in IMG/M |
Scaffold ID | Ga0302141_1131839 Open in IMG/M |
Source Dataset Name | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 675 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Abisko, Stordalen Mire | |||||||
Coordinates | Lat. (o) | 68.3532 | Long. (o) | 19.0477 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019018 | Metagenome / Metatranscriptome | 232 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0302141_11318391 | F019018 | AGGAG | MLRSKMATLLTIVSAMLISAGMTWQQRLLFIGGIAFGVVVEALPSLVDELKERVAEWRRF |
⦗Top⦘ |