NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116643_1000070

Scaffold Ga0116643_1000070


Overview

Basic Information
Taxon OID3300029928 Open in IMG/M
Scaffold IDGa0116643_1000070 Open in IMG/M
Source Dataset NameBaboon gut microbial communities from fecal samples in Kenya - M03
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDuke University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)90074
Total Scaffold Genes149 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (36.91%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)2.717Long. (o)37.1Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053097Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0116643_100007011F053097N/AMFDIVNNKIQLSTEDLAIPPFRDFYNNAKDKQDALKKIEFIVWRYKWNSPYEAYPEKERTWRVAKDVLND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.