NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119944_1002081

Scaffold Ga0119944_1002081


Overview

Basic Information
Taxon OID3300029930 Open in IMG/M
Scaffold IDGa0119944_1002081 Open in IMG/M
Source Dataset NameAquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hong Kong
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3500
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (30.77%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment Plant In Pearl River Delta Area, China

Source Dataset Sampling Location
Location NameChina: Pearl River Delta area
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007359Metagenome / Metatranscriptome352Y
F010746Metagenome / Metatranscriptome299Y
F016115Metagenome / Metatranscriptome249Y
F035200Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0119944_100208111F035200GAGGMNIRYIVLRDGYRVSEDMHTDLKEAEAEAEFWRSVVRRWPDGTKVIIKKIGGDKA
Ga0119944_100208112F010746N/AMTYKCVVSGEAIPPERVEALQVLGVPESQWTKKEYSQVKKLRAVYAGDDGSNDIVICDKVDGGSLFDSELIAEVEE
Ga0119944_100208113F016115N/ALKILEESFTSKGFKLQQVKRDGDVAIYKKQLDDPESENYHYEVIAIKKHNGYEIAGVKMPPAEMYPSDSQWGDWAYTCNTIEDATKRFNELQEKLTNYNATAISPSGEKRGRGRPRKIA
Ga0119944_10020816F007359N/AMQLVKQNLGAHWVIGIKGNKDRIEQFHNRIYNWGGTNGELQWMSESFAYFWITLEKLERVMFKYVMNSVTDKVGKKFRGAKGGLKEVVMNRVQNTIKNIPVENFLKTAQTQDFYTIGQVSAEKLDNDS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.