Basic Information | |
---|---|
Taxon OID | 3300029937 Open in IMG/M |
Scaffold ID | Ga0119934_1032599 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hong Kong |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 589 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053140 | Metagenome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119934_10325991 | F053140 | N/A | TELVTRAYDTDNLNHFQRRVYIDLATNRPKFSVSAFSEGANEESVLLTDQTYSRSETWKFADSAYDLNNANNDYNRAYRKDYSTGPDSVQCGTGFEPEMQQEFRLPLLTRRQGRLSWLEVTNTQGFISVMSLGYETRPGQRANLVQV |
⦗Top⦘ |