NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302186_10148346

Scaffold Ga0302186_10148346


Overview

Basic Information
Taxon OID3300030004 Open in IMG/M
Scaffold IDGa0302186_10148346 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)833
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0477Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062231Metagenome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0302186_101483461F062231N/ASLADGAAAKAPESEAPPELVQPLSAWRPRLHLALTLALATACVVLALLLAGSLRHDRTSASAQPAPAAQSDDLAWFWSPFLSPGSDPVIVIPNHPLLRAAHDGDSPATLASGHEIPKASLPEFRDTIHYRELKRFLFVPSLTDFTSVGETLGVVRLCNMFAGIGQKCNVQQSRLVNFDEIKGENAILLGGSQAWSGRVFLNTEGFQLQSGVILNRNPQPGEKPIYRPEFDPVTNQLTRDYALVLMLPNEKKENRVLLIYGIYTQGSQAAIEYLTNPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.