NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247826_10355025

Scaffold Ga0247826_10355025


Overview

Basic Information
Taxon OID3300030336 Open in IMG/M
Scaffold IDGa0247826_10355025 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1069
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044721Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0247826_103550253F044721AGGGGGMRGTPPATEALPMSVHVRHIAIDVLLDGDEISGRADDGTGRPKAFQGWLELLMALDGLLAQTDEEPSALR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.