NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302211_10202285

Scaffold Ga0302211_10202285


Overview

Basic Information
Taxon OID3300030491 Open in IMG/M
Scaffold IDGa0302211_10202285 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)586
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0469Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037381Metagenome / Metatranscriptome168N
F097208Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0302211_102022851F037381GGAMFFFEQTFQTVLNGIDAAGGPMGAITNIANAILLLCALFAVYEAYARGGDARMIGIAAAKFLILGLIVSNYSTIFRNVNGAFNQVAATISPNDWANNWMLQVNQYFNGLGNTNWFNLVVSSIVALVS
Ga0302211_102022852F097208N/ATAPMIEAQSAAMLVKAHALTQSATAELFRIRAIDMANTGAALKFNASHASDTRRDLTNMFMK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.