Basic Information | |
---|---|
Taxon OID | 3300030511 Open in IMG/M |
Scaffold ID | Ga0268241_10077964 Open in IMG/M |
Source Dataset Name | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 744 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Amatitan, Jalisco | |||||||
Coordinates | Lat. (o) | 21.053 | Long. (o) | -103.902 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018073 | Metagenome / Metatranscriptome | 237 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0268241_100779642 | F018073 | AGGAGG | MRRGGSLLITILLLLAAFWAGIQYERSNCKIDLPQTANQVGRTVKCRDYKGIDLPG |
⦗Top⦘ |