 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300030612 Open in IMG/M |
| Scaffold ID | Ga0257196_1093792 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 937 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Sophophora → willistoni group → willistoni subgroup → Drosophila willistoni | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Montana | |||||||
| Coordinates | Lat. (o) | 46.9233 | Long. (o) | -110.8694 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054605 | Metagenome / Metatranscriptome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257196_10937921 | F054605 | AGCAG | MMKSIPSLFAILISLLAIFTYTNAVIESYDEGHRPSWLAGSHQNRVRLFKKWLGNKQAGGHGASSPHDALHATPQFKGCIDPSEPFQCPQSERCIALQFICDGHPGDCPGNLDENEETCIAAKRPAKENIEKFLQAEYTLHGSKLFTFLFGQKLSKSIEDNSPVWFDTLASAFSVAKTIRNFAEKTKMSPDDLAHFQNVVEMIHDGRLEEIPIYAQEAVNQGLASLIEKLYESGFMDQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |