Scaffold Ga0308138_1058576

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308138_1058576

Scaffold Ga0308138_1058576

Overview

Basic Information
Taxon OID	3300030724 Open in IMG/M
Scaffold ID	Ga0308138_1058576 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	540
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location Name	Canada: Western Arctic Ocean
Coordinates	Lat. (^o)	75.0007	Long. (^o)	-150.0027	Alt. (m)		Depth (m)	20
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004316	Metagenome / Metatranscriptome	443	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308138_10585761	F004316	N/A	EIVVVGGIEFKEGIPGNCHLQHLTLCQAKGPGVYGYSSFTMDDVLVEQCSDHGVLASGTGVVGRCTNVEVRQCGGSGVFAFEGASITLIGAKTTVHHNCTDGNSWDYGLKVSWSSSSTIQLVSPLTKEQVSLDNGGGGNWGAERGADINQIKTMTESEITAAAVRMARDGVRVPEDCNT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.