NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265762_1000441

Scaffold Ga0265762_1000441


Overview

Basic Information
Taxon OID3300030760 Open in IMG/M
Scaffold IDGa0265762_1000441 Open in IMG/M
Source Dataset NameMetatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7185
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9992Long. (o)10.7901Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003137Metagenome / Metatranscriptome505Y
F006313Metagenome / Metatranscriptome376Y
F018033Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
Ga0265762_100044110F018033GGAGMRHNSPPAFACWFLESVVPVPLREAILGDLIEEYALRAESASPLAASRWFWSQTCRSVPTMAWSSLRSRDCLISLCIAMGVYIAVGALKLAADLTISRLVAPQQATYVVLAPVVFLTASAIGGCVAARIRRGATKFLALIVMTTVLVLIDIKVCTIPVPWWYQFGFLTLGPVTVLLTPAIFGVLKPPGGGSAT
Ga0265762_10004413F006313GGAMAMPNVKAGQIVVPEGLVGVYRVVSVSPDGLTADIEKFNVSKQMSLGDPVRSVATDKLSPYKEDATQAAARIVREAATED
Ga0265762_10004416F003137GGGGGMARKKKLKRFGAVQAVKEMARERVGAPPVEKVVPHKNKKAERHKPTLGRLLDETD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.