NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265763_1002403

Scaffold Ga0265763_1002403


Overview

Basic Information
Taxon OID3300030763 Open in IMG/M
Scaffold IDGa0265763_1002403 Open in IMG/M
Source Dataset NameMetatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1434
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9989Long. (o)10.7903Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020232Metagenome / Metatranscriptome225Y
F045388Metagenome / Metatranscriptome153N
F066033Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0265763_10024032F066033AGGCGGMTTQSRAVLQRILQRRTNWAPAGESFGCPRCHAKYAVIRRQMPPGMIPACETCDQEFPPAQDGEWLLYERADA
Ga0265763_10024033F045388GAGGVRSSHLTDDDLWRVIDDNTDAMSVLIEKQFELDGEAGAPDPDTRQKLMLFNVQAIDNYDRQYRDCIAEIRRRYPSI
Ga0265763_10024034F020232GGAGGMAEPSAEPIPPDYAEAFAYAVLVYEIWTPEEPGRLIEIGSRSFSIVEVCKLVDQFTDRLPERVYLKLRAYMHDDPDGKLKADLAADPSYATAVRCLRGMMERR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.