Basic Information | |
---|---|
Taxon OID | 3300030822 Open in IMG/M |
Scaffold ID | Ga0315851_104987 Open in IMG/M |
Source Dataset Name | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T21 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 923 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 33.7417 | Long. (o) | -117.7042 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038019 | Metagenome / Metatranscriptome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315851_1049871 | F038019 | N/A | TGSEAQTCRGCFRSACDTRETISNGLKLIRIRYRIPVCELPDLRAEDLNKYLSYLLLQGKERASVAFPRRQRRRRDSDGLFSLIRLLKHERWELAHSIASIKRNLPAGCRQHSLSARPAWEQNAFSIPPSSSPEYLRFVRREVSRIFPFGWDRNYDDFVWRHVPNPTARMTAKRADIFYCGKGKDFRRQCLTGRSIPIDQPIRARYKEVLSAGKCRPLVIYDETTEVLAPLHKAIDAHLMQQPWRLVGPPTEKKMSSVHVYPCQTSVDLVSASDNLSLEVTEAILGSLLRKSRIPGPLRVRAFQSLR |
⦗Top⦘ |