NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311366_10352468

Scaffold Ga0311366_10352468


Overview

Basic Information
Taxon OID3300030943 Open in IMG/M
Scaffold IDGa0311366_10352468 Open in IMG/M
Source Dataset NameIII_Fen_N2 coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1279
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0469Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015327Metagenome / Metatranscriptome255Y
F015623Metagenome / Metatranscriptome253Y

Sequences

Protein IDFamilyRBSSequence
Ga0311366_103524681F015623N/AQRKLITVTLEPDGTSKIDLDGFADSTCGKVMDDFRAGDRVVSERRKPEYYTQGRGQRVQQGNQ
Ga0311366_103524683F015327GGAGGMGPNALVECANELMRALKEELAERGTVTPAFILLHDSDCEVLSFSPRLFESPEGKAAVARAFRNRAHQTRAHGALVGLDSYCFIPDINAMSEANPRLVQAAAGAGIDALIRSGFGKTSEGLSVTLQTPAFHLLVQQLYARGD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.