NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308185_1003056

Scaffold Ga0308185_1003056


Overview

Basic Information
Taxon OID3300031081 Open in IMG/M
Scaffold IDGa0308185_1003056 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1510
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032479Metagenome / Metatranscriptome180Y
F051800Metagenome / Metatranscriptome143Y
F062613Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
Ga0308185_10030561F051800AGGAGMSTLTVVLRKPQADGKMMTRRFHNAEAYVNPTTKLLQVLRSDVPQIDGQEILAEFPSETYLSWE
Ga0308185_10030562F032479GAGGMTYQWYYYNKVYSDRTAFVWDVGTVHILPLRMSEALASERVPDLILSYGFTHKMQRTIPPSSTHSHGKSAPVLL
Ga0308185_10030563F062613GAGMPTIRVILKSIDTDGRIMTKRYKNAKAYVNPTTNLLQVYRSDDPSCEDQEMLAEFHADTYLSWE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.