NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0061018_10675937

Scaffold Ga0061018_10675937


Overview

Basic Information
Taxon OID3300031085 Open in IMG/M
Scaffold IDGa0061018_10675937 Open in IMG/M
Source Dataset NameCoassembly of Cow X and Y Rumen Fluid
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)615
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location
Location NameUSA: Illinois
CoordinatesLat. (o)40.102108Long. (o)-88.227299Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028419Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0061018_106759371F028419N/AKANVNNVIANSLLSVHDISANLNDKYTFATRHYFQVNLWDIRMQNSPSSKFLTYEPIINRLTYLYQNNYLSDKFSLDADKSGKYILTGGYNNMFHVIDISQRLNTQIIIDDVNEKLMNTNVVRRVNAKGSCGYKKDDPHAQNVNFDKKILHQAYSPVENYALLIVYNCIYSYSGNIAKKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.