NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308204_10069318

Scaffold Ga0308204_10069318


Overview

Basic Information
Taxon OID3300031092 Open in IMG/M
Scaffold IDGa0308204_10069318 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)906
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023069Metagenome / Metatranscriptome211Y
F041303Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0308204_100693181F023069GAGMDTNGARAYTTPGEQEPSPAEALRRLQQQVAELQAYVTHFVSAKIDGFVLSARQMALWVALGVMALTAAVGLVVTAVVLVLIGAADGFALLFGGRWWLGAVVVGGGTLILLVLGILIGMRTWQSRWRQQKVQQYDERQLQQYATFGHSVADRATEETALQH
Ga0308204_100693182F041303N/AMRPSDTALLTEPQKKRHYNTDDERIFLAQQAADAKTAMQHTVADMQATVKEAANVSWWTQQYPWYAVGAATVLGFIAVTSVLPPPDHRTRPASPAASQESARPSWTASLFGMVRIMLMGIITEALNTKGQQSGRAQPAQADASVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.