Basic Information | |
---|---|
Taxon OID | 3300031113 Open in IMG/M |
Scaffold ID | Ga0138347_10468985 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 639 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Atlantic ocean | |||||||
Coordinates | Lat. (o) | -22.5 | Long. (o) | -33.0 | Alt. (m) | Depth (m) | 150 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049661 | Metatranscriptome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138347_104689851 | F049661 | N/A | DRGYTKSGSDLALDDCSDCLPDGITVPSVKYCSDTDEVQVTVKDKVVPLPIKATLKKVSCSSSTETEFASCTGSDDPVITQKTCYRGSAGALGLTETVTVSLKTFASGQGTLDYSGTGIEAFTCADKTLTKSGQDITFSDSSDCLPDGIEVSAVKYCSDSDTIKVTVKDKVVPLPISAILSKIDCPSTVEV |
⦗Top⦘ |