Scaffold Ga0138347_10754812

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138347_10754812

Scaffold Ga0138347_10754812

Overview

Basic Information
Taxon OID	3300031113 Open in IMG/M
Scaffold ID	Ga0138347_10754812 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	701
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Goniodomataceae → Pyrodinium → Pyrodinium bahamense	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location Name	Southern Atlantic ocean
Coordinates	Lat. (^o)	-22.5	Long. (^o)	-33.0	Alt. (m)		Depth (m)	150
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043171	Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138347_107548121	F043171	N/A	SPWCKDWMMCIKGKANPAQTPEAVMSAWDPADCKEICGSWSNMTPKEGAKKSFLQLFNPSKAIAGLLHLDSSSSNDCLKSCGNFQKSLSGCVAKIMFEPGKVAAMGLPKPGGKAPAEICTKKDSPCMPDLPIKAQKCMGHKTKKVLDKSYDIPAEVEQGCKFIKMNMEDCKKCPQVQGGSLSEYAAFTGGCMDQLNAYWQATHPKAGEAAIPGAKGCTVH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.