Scaffold Ga0318490_1411556

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0318490_1411556

Scaffold Ga0318490_1411556

Overview

Basic Information
Taxon OID	3300031116 Open in IMG/M
Scaffold ID	Ga0318490_1411556 Open in IMG/M
Source Dataset Name	Metatranscriptome of forest soil fungal communities from Los Alamos, New Mexico, United States - Jemez Pines Pi 5A (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	524
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Tubulinea → Elardia → Arcellinida → Sphaerothecina → Arcellidae → Arcella → Arcella intermedia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Forest Soil Microbial Communities From France, Sweden And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location Name	USA: New Mexico
Coordinates	Lat. (^o)	35.8911	Long. (^o)	-106.2978	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008600	Metagenome / Metatranscriptome	330	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0318490_14115561	F008600	N/A	IFSFTTGMLFLWSGGTGEKVYVPPDHTSNIPVQKIQVAGTGEKVYVPPDHTSNIPVQKIQVDGTGEKVYVPPDHTSNIPVAKIQVGGTGEKTYVPPDHISNIPVVKEQASAKGQSWAPPDGSVPTVKEQPGVKGSLKYVPPDHKNNIPVVKEKIDYL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.