Basic Information | |
---|---|
Taxon OID | 3300031117 Open in IMG/M |
Scaffold ID | Ga0061012_10374241 Open in IMG/M |
Source Dataset Name | Coassembly of Cow X Rumen Fluid |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 575 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Illinois | |||||||
Coordinates | Lat. (o) | 40.102108 | Long. (o) | -88.227299 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059550 | Metagenome / Metatranscriptome | 133 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0061012_103742411 | F059550 | N/A | LCQIKPAPTDSQNINNYKSSLPSDYFTKYPTYNGTPKEFPSKTKKPLQLTTKAYLVQKIDRKSIEDLPPKEQMIDFNKFLLQFNSIDEIKNLTPIDLFDIDSKLLEQLKEKCRNFTDVAAKISEEKEKQGQMEEAKNDQEFMQYLMNQYIELQNNSINVDIAINTIDKIKNLQYNAEGVKVFFKN |
⦗Top⦘ |