Scaffold Ga0308025_1082477

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308025_1082477

Scaffold Ga0308025_1082477

Overview

Basic Information
Taxon OID	3300031143 Open in IMG/M
Scaffold ID	Ga0308025_1082477 Open in IMG/M
Source Dataset Name	Marine microbial communities from water near the shore, Antarctic Ocean - #422
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1198
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-68.5596	Long. (^o)	77.8957	Alt. (m)		Depth (m)	37
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013024	Metagenome / Metatranscriptome	275	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308025_10824773	F013024	AGAAG	MKVENIEKPTTKFIATKLFWVGVLGTYILAGILLNRLETNAGYEELRTSSLIPSIFYFFILFLSYRSFETQAVKTTILQFVTQMLLLLPLMSMYMAVVLFTTKFSS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.