Basic Information | |
---|---|
Taxon OID | 3300031231 Open in IMG/M |
Scaffold ID | Ga0170824_113276415 Open in IMG/M |
Source Dataset Name | Coassembly Site 11 (all samples) - Champenoux / Amance forest |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 893 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | France: Mazerulles, Grand Est. | |||||||
Coordinates | Lat. (o) | 48.7585 | Long. (o) | 6.3578 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006133 | Metagenome / Metatranscriptome | 380 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0170824_1132764152 | F006133 | N/A | MQSLLQVRVFVLMALIALLVSPFFLTSTLSVGIERKAQDVEDCVACRYIWLQVEMDVGNSQIEENIYDSFTQNCIEAQKAPIFYPACQDMFDGIDDMIGDYMDGYTVNQLCENARLCR |
⦗Top⦘ |