Basic Information | |
---|---|
Taxon OID | 3300031341 Open in IMG/M |
Scaffold ID | Ga0307418_1168268 Open in IMG/M |
Source Dataset Name | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 557 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Massachusetts | |||||||
Coordinates | Lat. (o) | 42.759 | Long. (o) | -70.891 | Alt. (m) | Depth (m) | .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030904 | Metagenome / Metatranscriptome | 184 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307418_11682681 | F030904 | N/A | MARAAVKAKQQAKAKAKAQPAKAGRRTRGRRGHASGGNPNQQLFFSRLRRQAKFMYVLLAVLFAVTFAFLGVGSGSSGLSDLFSGLSIFGGGGGSSISK |
⦗Top⦘ |