NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307505_10001848

Scaffold Ga0307505_10001848


Overview

Basic Information
Taxon OID3300031455 Open in IMG/M
Scaffold IDGa0307505_10001848 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15934
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)48.4473Long. (o)-122.323Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002324Metagenome571Y
F101835Metagenome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0307505_100018482F002324GGAGGMGEVRLFQICYEGDLTVEVSHVMRRLGAEPNFDQSWQVFLPEGRHAAALVRYLRAQLAGDARLLVACTQFTTTRDFLLVRHSLTPGADYSELHDALARLGVVVELPFESTFVIQSDDRTDVRNLGEALGELCPDESIMVTGISHDWAYSNSGQSRMYVADALEDAQFKAF
Ga0307505_100018488F101835GAGGMSESCRFESDVLRASSEDRWTESLRRHLTECDECIATASVAPWMGRFARIGDREHILPDPQIVWLKAQLLQGSIDVARISRPMNIVQMVSYLVVAGGWAALLTWKWELVEKWMTGFTPTGIMQNVTRAEALPITFLALVLILATMTVTLALHTILAEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.