Scaffold Ga0307388_10291335

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307388_10291335

Scaffold Ga0307388_10291335

Overview

Basic Information
Taxon OID	3300031522 Open in IMG/M
Scaffold ID	Ga0307388_10291335 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1028
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)	-51.9926	Long. (^o)	2.0992	Alt. (m)		Depth (m)	50
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060576	Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307388_102913351	F060576	AGGA	MRAAILVAVFASATAWSLNYHETKHSLHASHHAETGLRGSVTQPSIPGVPAAPKIFPVPTTSRCIVIMICQYMLVFTAIAVIRSYHELSGTPKGSLAAGLAAAAQTVTYGPMLCVLFIACRMRVEFLSDGKGQPQMWVQNCMYGVTFAVLGSTIVVLLLPLLTGKPVALKEGTGDMEKPDESEAGSKSVFYALSAIRYGILLGLYGGLVGVIVGICTYLPPGETDLVKLPAPAPAVMCTIILASLFFAMQLVIAACRTYAEFTGVEFPRIIGVMNGATNTVEFAPQLAILFIAARMRALQHDGQPQPWAQQCMFAATFAL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.