Scaffold Ga0302326_12160351

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0302326_12160351

Scaffold Ga0302326_12160351

Overview

Basic Information
Taxon OID	3300031525 Open in IMG/M
Scaffold ID	Ga0302326_12160351 Open in IMG/M
Source Dataset Name	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	712
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Abisko, Stordalen Mire
Coordinates	Lat. (^o)	68.3532	Long. (^o)	19.0477	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013449	Metagenome / Metatranscriptome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302326_121603511	F013449	GGA	MNSVPWRVQIGLVVFGYAAALVIAAALLFMRHLQEVENPVDASGGMWAAGDLFLYIFIVCLFMVPTAFLILITAKFEAFYTAYSKFLLGLSLTAPICLGVLSLGEHHIGESLMNLCLYRLIWVPFIFVGMGISWLAARFDRAKRFVSYALLTEGLTFAIAIVQLIHSMAGPKTH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.