Scaffold Ga0307380_10000814

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307380_10000814

Scaffold Ga0307380_10000814

Overview

Basic Information
Taxon OID	3300031539 Open in IMG/M
Scaffold ID	Ga0307380_10000814 Open in IMG/M
Source Dataset Name	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	46907
Total Scaffold Genes	82 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (20.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location Name	Finland: Risofladan, Vaasa
Coordinates	Lat. (^o)	63.0472	Long. (^o)	21.7116	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028664	Metagenome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307380_1000081475	F028664	N/A	MKTETKILIGGQALRILGSTRATNDIDYLINIDSKEAFLHEENVDYLNAKRNKFFAEIFKAEKGNQIASPQSLLELKAYAFVQHLQNYNFQKADDAEYDMKFLVRKFNLTINIVRNYVSSGELSEIMKVINSTKI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.