NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318538_10200102

Scaffold Ga0318538_10200102


Overview

Basic Information
Taxon OID3300031546 Open in IMG/M
Scaffold IDGa0318538_10200102 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1066
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005548Metagenome / Metatranscriptome397Y
F012379Metagenome / Metatranscriptome281Y
F015268Metagenome / Metatranscriptome256Y

Sequences

Protein IDFamilyRBSSequence
Ga0318538_102001021F005548N/ARVLRWLRSLFGRGRGDESSSPIREADAYARSYGERSGEIVSVVRQEPKPIPRRTGDMTGELLRRAFEAKLDLRGKTKT
Ga0318538_102001022F012379GAGVFWVGEDRECVRGFPIGPALLEALGEINRDVQVALADERARLSEHGYSEDLPVPALWWVPAPGVEAEAAEQLHAAVPATA
Ga0318538_102001023F015268GGAMRVMAHVVWSVRRGKVGEFDAPELLSGYRSASPIHEPKLGDVLRLPDGSGSWRVIDWRVTRRSDSPQKVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.