NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310887_10295820

Scaffold Ga0310887_10295820


Overview

Basic Information
Taxon OID3300031547 Open in IMG/M
Scaffold IDGa0310887_10295820 Open in IMG/M
Source Dataset NameLab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)921
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011923Metagenome285Y
F055520Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0310887_102958201F055520GGAGGMPKIYVNTDNSNSKAKIYEAGKMGKSAAAAEQKIRDVVTDMVAKEPDFVSDKSAVGKGYTIRIKVTNATTAAGTTTYTVHPEIVRFPKEFMVSTVVKDIEIQVQGHSEEMLLDAVGDATQKIMKKCF
Ga0310887_102958202F011923AGGAGMKMYLALAVAAVFAMSPLSGVAGEKKVAEVKELAGSWRGWVTAEMGDERATMSVQTDGSYKASTTRGSTSEGRFYLQD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.