NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307408_100020456

Scaffold Ga0307408_100020456


Overview

Basic Information
Taxon OID3300031548 Open in IMG/M
Scaffold IDGa0307408_100020456 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4468
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036344Metagenome / Metatranscriptome170Y
F064075Metagenome129N

Sequences

Protein IDFamilyRBSSequence
Ga0307408_1000204564F036344GGAMFLIEARRMRRGDQPAGIARFIVTGGSRYAALSKLRVYYDTSDIDSLTATPVSGIIPIAGALVHDMRRATPESEATQAHEKPDASDDDEPWKRSA
Ga0307408_1000204565F064075N/AMRPHPFVTALAFAVLSATTAGAQASTQSGQSSAQSSPTCHRCLNGFRFVPSSVVDEPFVNTSFENATGGGMALNLNVPVRNLDGEPVDTLNGNIGFFLLDFEYQKSIAKWLALRVGVTGIGRLGTSLEALVASGISAAMGGYIGATVPVWSKPNFLISAVADLKNNKQWDVDPYTFVKDVVDSGYNDTTKAVLLGSERVNRWSFGLRGAWAVKPWMGLTANIEPGGADGDVSGNKSLNTFGVLAGFDLHQLWGVPISTSLAYRVRTGSGKSGNISGGYRSAQLGVFYNALSSVLIGGDFFYSTIRVQGGSIPDLDAVQFRLVTHIDF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.