Scaffold Ga0318466_11449075

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0318466_11449075

Scaffold Ga0318466_11449075

Overview

Basic Information
Taxon OID	3300031555 Open in IMG/M
Scaffold ID	Ga0318466_11449075 Open in IMG/M
Source Dataset Name	Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples.(v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1053
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.4204	Long. (^o)	-119.6671	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092993	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0318466_114490752	F092993	AGGA	MGEITTMVADARYPHDQHIYDYFTATEKFVRTVVPQLFQDCMEQFREQLVVEFETYLNGQKIHHDQLATAIGDILERSIGEAVKNVSIRI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.