Scaffold Ga0307436_1001342

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307436_1001342

Scaffold Ga0307436_1001342

Overview

Basic Information
Taxon OID	3300031563 Open in IMG/M
Scaffold ID	Ga0307436_1001342 Open in IMG/M
Source Dataset Name	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10942
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (81.82%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location
Location Name	USA: Massachusetts
Coordinates	Lat. (^o)	42.759	Long. (^o)	-70.891	Alt. (m)		Depth (m)	.4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041287	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307436_10013429	F041287	AGGAG	MEKCFKCGREAQYICPECGAKACRAHMETRYTGPDRGFRSRYMCPKCWKKKRVVLNENMVDAKEYRPKTYVWSK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.