NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302131_1013218

Scaffold Ga0302131_1013218


Overview

Basic Information
Taxon OID3300031594 Open in IMG/M
Scaffold IDGa0302131_1013218 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB9_20m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3617
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)77.9995Long. (o)-150.0065Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002542Metagenome / Metatranscriptome550Y
F037238Metagenome / Metatranscriptome168N

Sequences

Protein IDFamilyRBSSequence
Ga0302131_10132182F037238GGAGMSFRSFDLLNLIKRHGESLTLRKVTTNGAYNPATGAVDGSATTDYTITAYLYNYNVGVPAGNDEVVRGSRKCVISALGLDAIPDFDDLIVGSGDTVKITSVMSIFSAGTAIGYICNVGE
Ga0302131_10132184F002542GGAGMHPTYLGWQVDWPVFVKLPLMADSKNWKRGDHFNWAERNLEQDKIATLYAAGYLHHNRDLEVQNKVGDRLSELAGKELESLVNLLNVEVKSRTSSSAEFEAKKCKKSRVDDKQRGLIRRFLNGNRWITEDFYEIRDKVLSD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.