NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308014_1021738

Scaffold Ga0308014_1021738


Overview

Basic Information
Taxon OID3300031628 Open in IMG/M
Scaffold IDGa0308014_1021738 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #229
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1667
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5596Long. (o)77.8957Alt. (m)Depth (m)37
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081741Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0308014_10217381F081741N/AMVDPLLAVVLATCSGAILNTIRGFLGSNEPKYDIKKFLGAVIVSGFAGIAIAQTISLSGIDTLGLILIGLTAGFTI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.