NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307985_10085382

Scaffold Ga0307985_10085382


Overview

Basic Information
Taxon OID3300031629 Open in IMG/M
Scaffold IDGa0307985_10085382 Open in IMG/M
Source Dataset NameMarine microbial communities from Ellis Fjord, Antarctic Ocean - #80
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1269
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5958Long. (o)78.1913Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018266Metagenome / Metatranscriptome236N
F025387Metagenome / Metatranscriptome202Y
F026154Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0307985_100853821F018266N/AIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKTPSVRVVTIPTSSDRRELLVLNKIYGGDNET
Ga0307985_100853823F026154AGGAGMNGIFTVIRFVTYTVGGLTIRKGWNWLMADIDPIPGSKEFDIEYYQTKEKYIRLTKKKENYDETCREVRRADR
Ga0307985_100853824F025387GGAMTKRVEKLGEQIVRLITYPIRATIGVCQCIHKSTPDTLDDCMPFEIKKKEDKNADNV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.